If you have been reading about HGF mimetic and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-07-08. Where a claim depends on a specific study, the study is described rather than over-claimed.
The compound has been examined in animal models for effects on learning, memory, and synaptic connectivity. Some reports describe increased dendritic spine density and improved performance on certain behavioral tasks after administration in rodents. These findings are often cited in discussions of nootropic research peptides, but replication across independent laboratories remains limited. The absence of published phase 1 or phase 2 clinical trial data makes it difficult to assess safety, effective routes, or long-term outcomes in humans. Consequently, claims about cognitive benefits in people remain speculative.
Dihexa is not approved as a medicine in major regulatory jurisdictions. It is commonly sold as a research chemical for laboratory use, though such products may not be standardized or independently verified. Scientific literature on dihexa includes in vitro assays, rodent studies, and reviews that discuss its proposed mechanism. The distinction between peer-reviewed findings and commercial promotion is important when evaluating available information. Open questions include its precise binding interactions, pharmacokinetics, and whether animal results translate to human biology.
Discussion of dihexa in online communities sometimes outpaces the scientific record. Anecdotal reports are difficult to verify and may not distinguish effects from placebo or expectation. The absence of approved human data means long-term risks remain unknown. Researchers continue to investigate related compounds and pathways. Open questions include whether animal findings translate to humans and which biological targets matter most. No consensus exists on these points. Current reviews emphasize the need for rigorous clinical research.
Most published work on dihexa consists of preclinical studies using cell cultures or rodents. Reports have described effects on synaptic connectivity and performance on cognitive tasks in some animal models. These findings are generally presented as preliminary and require independent replication. Study designs, doses, and outcome measures vary across experiments, which complicates direct comparison. No large controlled human trials have established efficacy or safety for any medical use. At present, the evidence base is limited.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic peptide | Derived from angiotensin IV and modified for stability. |
| Proposed mechanism | c-Met/HGF pathway activation | Described as an HGF mimetic in experimental systems. |
| Common synonyms | Dihexa; N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide | Name usage varies by supplier and publication. |
| Regulatory status | Not approved as a drug | Sold as a research chemical in some markets. |
| Human trial data | Limited or absent | Most evidence comes from preclinical studies. |
The proposed mechanism involves interaction with the hepatocyte growth factor (HGF) system and its receptor, c-Met. Dihexa is described in some studies as an HGF mimetic, meaning it may mimic or enhance HGF-mediated signaling. Activation of c-Met can influence cell growth, survival, and cytoskeletal remodeling, pathways that intersect with synaptic plasticity. However, the precise binding targets and downstream events for dihexa are not fully established, and alternative mechanisms have been suggested.
Dihexa is a synthetic peptide with the chemical name N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide, and it is structurally related to angiotensin IV, a naturally occurring peptide fragment. Researchers developed it as a modified analog intended to alter stability and activity relative to the parent peptide. Its short sequence and fatty acid chain distinguish it from many endogenous peptides, and published studies often describe it under the abbreviation dihexa. The compound is classified as a laboratory compound rather than an approved therapeutic in most jurisdictions.
The angiotensin IV connection places dihexa in a family of short peptides studied for effects on central nervous system signaling. Angiotensin IV itself is a metabolite of angiotensin II, and analogs have been explored in cardiovascular and neurological research. Dihexa differs from the natural peptide through structural modifications intended to alter stability and receptor interactions. Published descriptions sometimes call it a hepatocyte growth factor mimetic, although that label reflects proposed activity rather than a confirmed clinical mechanism.
Identity checks for dihexa usually rely on mass spectrometry and chromatographic purity analysis. A lyophilized powder is the common supplied form, and it may appear as a white to off-white solid. Aqueous solubility is limited, so laboratory work often uses an organic solvent such as dimethyl sulfoxide to prepare stock solutions. Because the peptide is not a standard pharmaceutical product, exact specifications can vary between suppliers. Certificates of analysis may accompany a batch, but they are not equivalent to regulatory approval.
Dihexa is a synthetic peptide whose structure is modeled on angiotensin IV. Its chemical name often appears as N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide, though vendor and publication naming can differ. The molecule combines a short amino acid sequence with a hexanoic acid group and an amide terminus. It is classed as a small research peptide rather than a conventional drug. Databases may list it under several synonyms, so matching names are important when comparing sources.
The proposed mechanism for dihexa centers on hepatocyte growth factor, or HGF, and its receptor c-Met. HGF signaling is involved in cell growth, survival, and synapse formation. Dihexa has been described as an HGF mimetic or modulator in preclinical literature. Whether it binds c-Met directly, increases HGF availability, or acts through another route remains uncertain. This mechanistic uncertainty is a recurring theme in reviews of the compound, and no single molecular model has been confirmed across independent laboratories.
Research on dihexa has primarily used rodent models and cultured cells. Common endpoints include dendritic spine density, synaptic protein expression, and performance on maze or avoidance tasks. Some studies report improvements in cognitive measures after scopolamine-induced deficits or in aged animals. These findings are interesting but come from a small body of work, and independent laboratories have not consistently replicated all reported effects. Larger, preregistered studies would help clarify which results are robust.
ASQ provides its members with certification, training, publications, conferences, and other services. ASQ is a founding partner of the American Customer Satisfaction Index (ACSI), a quarterly economic indicator. Since 1989, ASQ has administered the annual Malcolm Baldrige National Quality Award. The ASQ also gives the Dorian Shainin Medal, which is awarded annually for the "Development and Application of Creative or Unique Statistical Approaches in the Solving of Problems Relative to the Quality of Product or Service".
Alpha cells are endocrine cells, meaning they secrete a hormone, in this case glucagon. Alpha cells store this glucagon in secretory vesicles that typically have an electron dense core and a grayish outer edge. It is believed that alpha cells make up approximately 20% of endocrine cells within the pancreas. Alpha cells are most commonly found on the dorsal side of the pancreas and are very rarely found on the ventral side of the pancreas. Alpha cells are typically found in compact Islets of Langerhans, which are themselves typically found in the body of the pancreas. Alpha cells function in the maintenance of blood glucose levels. Alpha cells are stimulated to produce glucagon in response to hypoglycemia, epinephrine, amino acids, other hormones, and neurotransmitters.
Professional APCs describe those APCs which are capable of delivering all 3 signals needed to activate a naive T cell (signal 1- the antigen itself, the peptide-MHC complex; signal 2 - costimulatory ligand; signal 3- cytokines to guide polarization of the T cell). Canonically, the 3 pAPC types are dendritic cells, macrophages, and B cells. They are very efficient at internalizing antigens, either by phagocytosis (e.g. macrophages), or by receptor-mediated endocytosis (B cells), processing the antigen into peptide fragments and then displaying those peptides (bound to a class II MHC molecule) on their membrane. The T cell recognizes and interacts with the antigen-class II MHC molecule complex on the membrane of the antigen-presenting cell. An additional co-stimulatory signal is then produced by the antigen-presenting cell, leading to activation of the T cell. The expression of co-stimulatory molecules and MHC class II are defining features of professional APCs. All professional APCs also express MHC class I molecules as well. The main types of professional antigen-presenting cells are dendritic cells, macrophages and B cells.
Bone morphogenetic proteins (BMPs) are a group of growth factors also known as cytokines and as metabologens. Professor Marshall Urist and Professor Hari Reddi discovered their ability to induce the formation of bone and cartilage, BMPs are now considered to constitute a group of pivotal morphogenetic signals, orchestrating tissue architecture throughout the body. The important functioning of BMP signals in physiology is emphasized by the multitude of roles for dysregulated BMP signalling in pathological processes. Cancerous disease often involves misregulation of the BMP signalling system. Absence of BMP signalling is, for instance, an important factor in the progression of colon cancer, and conversely, overactivation of BMP signalling following reflux-induced esophagitis provokes Barrett's esophagus and is thus instrumental in the development of esophageal adenocarcinoma. Recombinant human BMPs (rhBMPs) are used in orthopedic applications such as spinal fusions, nonunions, and oral surgery. rhBMP-2 and rhBMP-7 are Food and Drug Administration (FDA)-approved for some uses. rhBMP-2 causes more overgrown bone than any other BMPs and is widely used off-label.
Division of analytical chemistry and laboratory of bio-electrochemical biosensor research function in this department. The division conducts research in the area of methods of electrochemical analysis using chemically modified electrodes and biosensors. The head of the department is Professor Gennady A. Evtyugin, doctor of Science in chemistry. The Department conducts research in the following fields:
Sources: en.wikipedia.org
BC Research Inc. is a privately owned Canadian process technology incubator, specializing in custom research, process development and technology commercialization. Headquartered in Vancouver, British Columbia, BC Research operates primarily from their Technology Commercialization and Innovation Centre on Mitchell Island in the Vancouver suburb of Richmond. This 40,000 sq-ft facility includes a 28,000 sq-ft pilot plant development area, 2,500 sq-ft laboratory space, 9,000 sq-ft of office space, as well as a small machine shop and fenced outdoor piloting space. Technologies are scaled up from concept to pilot or demonstration scale in preparation for commercialization. Engineering support is provided by sister companies NORAM Engineering and Constructors Ltd. Previously, BC Research was located at the BC Research and Innovation Complex at the south end of the University of British Columbia campus. This facility closed in November 2007. The company specialized in consulting and applied research and development in the area of plant biotechnology and environment, health and safety, process and analysis, transportation and ship dynamics.
2-Oleoylglycerol (2OG) is a monoacylglycerol that is found in biologic tissues. Its synthesis is derived from diacylglycerol precursors. It is metabolized to oleic acid and glycerol primarily by the enzyme monoacylglycerol lipase (MAGL). In 2011, 2OG was found to be an endogenous ligand to GPR119. 2OG has been shown to increase glucagon-like peptide-1 (GLP-1) and gastric inhibitory polypeptide (GIP) levels following administration to the small intestine. 2OG has also been discovered to potentiate G protein and not β-arrestin signaling via allosteric binding of the 5-HT2A receptor. 2-Arachidonoylglycerol JZL184
A number of AlphaFold clones have also been published, mostly with permissive license terms. Clones for AlphaFold3 include ByteDance's Protenix (Apache 2.0 License), AlQuraishi Laboratory's OpenFold-3 (MIT license), and Boltz-1/2 (MIT license). There are also clones for older versions, though they became less relevant with the open-source release of AlphaFold 1 and 2 source codes. Still relevant are models, both open- and closed-source, that include modifications to the AlphaFold architecture. For AlphaFold 2, a notable example is ESMFold from Meta, which replaces the multiple sequence alignment with the latent space of a protein language model. Open-source tools that complement AlphaFold have also been made. One well-cited example is ColabFold, which uses MMseqs2 instead of HHblits to speed up the sequence search, allowing the AlphaFold pipelines to run quickly on Google Colab.
AAV is of particular interest to gene therapists due to its apparent limited capacity to induce immune responses in humans, a factor which should positively influence vector transduction efficiency while reducing the risk of any immune-associated pathology. AAV is not considered to have any known role in disease. However, host immune system response and immune tolerance reduce the efficacy of AAV-mediated gene therapy. Host immune response has been shown to respond to the AAV vectors, the transduced cells, and the transduced proteins. The immune response can be subdivided into two categories: innate and adaptive, the latter of which is divided into humoral and cell-mediated.
Bruce Randall Donald (born 1958) is an American computer scientist and computational biologist. He is the James B. Duke Professor of Computer Science and Biochemistry at Duke University. He has made numerous contributions to several fields in Computer Science such as robotics, Microelectromechanical Systems (MEMS), Geometric & physical algorithms and computational geometry, as well as in areas of Structural Molecular Biology & Biochemistry such as Protein design, Protein Structure Determination and Computational Chemistry.
Sources: en.wikipedia.org
Gepants (eg. rimegepant, ubrogepant, and atogepant) are also a new group of anti migraine drugs, along with ditans. They are calcitonin gene-related peptide (CGRP) receptor antagonists. Gepants have been suggested to have less pain relief at 2 hours compared to triptans. Similar to ditans, they offer another therapy option that does not include vasoconstriction, thus may be suitable for those with cardiovascular risk factors. They are well tolerated with fewer adverse effects compared to triptans .
Bone morphogenetic proteins (BMPs) are a group of growth factors also known as cytokines and as metabologens. Professor Marshall Urist and Professor Hari Reddi discovered their ability to induce the formation of bone and cartilage, BMPs are now considered to constitute a group of pivotal morphogenetic signals, orchestrating tissue architecture throughout the body. The important functioning of BMP signals in physiology is emphasized by the multitude of roles for dysregulated BMP signalling in pathological processes. Cancerous disease often involves misregulation of the BMP signalling system. Absence of BMP signalling is, for instance, an important factor in the progression of colon cancer, and conversely, overactivation of BMP signalling following reflux-induced esophagitis provokes Barrett's esophagus and is thus instrumental in the development of esophageal adenocarcinoma. Recombinant human BMPs (rhBMPs) are used in orthopedic applications such as spinal fusions, nonunions, and oral surgery. rhBMP-2 and rhBMP-7 are Food and Drug Administration (FDA)-approved for some uses. rhBMP-2 causes more overgrown bone than any other BMPs and is widely used off-label.
AlphaKnot is a scientific database and web server for detecting, classifying, and visualizing protein knots and other forms of protein-chain entanglement. It was developed to facilitate the analysis of protein structures predicted by AlphaFold and other machine-learning methods, but can also be used to analyze experimentally determined structures. The current version, AlphaKnot 2.0, combines two closely related components: a precomputed database containing proteins identified as knotted in large-scale structure-prediction datasets, and an analysis server that allows users to investigate the topology of individual protein structures in greater detail.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Dihexa is a synthetic peptide derived from angiotensin IV and studied for effects on synaptic plasticity. It is often described as a hepatocyte growth factor mimetic. It is not an approved medication.
It is based on angiotensin IV, a naturally occurring peptide fragment, but dihexa itself is chemically modified and synthetic. The modifications aim to improve stability and activity compared with the parent fragment.
Laboratory studies have used cell-based assays and rodent models. These examine receptor signaling, dendritic spine changes, and behavioral tasks. Published human clinical trial data are lacking.
Published human trials are lacking. Most evidence comes from laboratory and animal studies. Therefore, human benefits and risks are not established.